PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc009830.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 201aa    MW: 21962.8 Da    PI: 8.8655
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc009830.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR131.84.5e-1062104245
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeek 45 
                              fY eY++ vGF+vr+s+ k+  rng++t r++vCs++g+++  +
  Itr_sc009830.1_g00001.1  62 FYFEYGRAVGFDVRRSTVKND-RNGNTTVRHLVCSRQGFKQVVR 104
                              9**************997776.8899*************98655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.1E-762104IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
ILGCVRCLHG VSFGSVDTFS PETDSTTTYT SNDTKFWAPI SEDSITPHIG QVFGTVEQGE  60
VFYFEYGRAV GFDVRRSTVK NDRNGNTTVR HLVCSRQGFK QVVRDQFAEL EVGNGVAVGG  120
EDQERILMVS NAVQALRESL SVGDDSTPMR RGKHSVIENF TGNVAVDPVV VIRPTVVARN  180
KGRGKRLKGG REIAVTMKKP G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28530.15e-07FAR1-related sequence 10